PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna12898.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Nin-like
Protein Properties Length: 535aa    MW: 59569.7 Da    PI: 4.3803
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna12898.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK81.31e-25423472352
                   RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                              + ++le +++yF+lpi++AAkeL+v++T+LKr+CR+++I+RWPhRkiksl
  mrna12898.1-v1.0-hybrid 423 DALELEGIKQYFNLPITKAAKELKVGVTLLKRRCRELNIMRWPHRKIKSL 472
                              6799********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.291406493IPR003035RWP-RK domain
PfamPF020424.4E-22425472IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MEYNTQQLVD PEIEENPLEC DYLGYHYQDP LPNSTTSMFE APQIDHGFNS VALPLPEDNN  60
QIPHMGFQGL EDFSLRDYTA LDIANTFSSS PLCDFNNVLD GKTHTTVLES FGESSNDPSD  120
MMIGSSGFSS TQCDSVLFDE KPISTMVDSF DYLINNSTNL GYHAMIESSG FSSSLCDSLV  180
FDDMLLREMV ESLNNNVPSD VGQHEVSMMV ESSRFSSTQC DSVVFDEKPI STMVDSFDYL  240
INNSTNLGHH AMIESSGFSS SLCDSLVFDE MLLREIVESL NNNVPSDVGQ HEVSMMVGSS  300
GFSSTQCDSV VFDEKPISTI VESFGNSSNV PSVFDHHEAS MVTESSAAYS SSHCNALVLY  360
ETPLSTIVDS FDYSDMPTPD LSDEEVSVKI ESGYPSWGTS DTSCLRGTSN RGRCSTQMKI  420
KSDALELEGI KQYFNLPITK AAKELKVGVT LLKRRCRELN IMRWPHRKIK SLNSLIETMK  480
RMGLRNEVKM LEENKRLLEL VPNMELTKRT KRLRQSIFKA NYNKKKMSLS ISLG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004309145.10.0PREDICTED: uncharacterized protein LOC101293942 isoform X2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.11e-37RWP-RK domain-containing protein